Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA78594_AD13.jpg Application Data (Figure-4: HPLC analysis of PD-L1/hFc recombinant protein.)

PD-L1 recombinant protein

Human PD-L1 Recombinant Fc fusion Protein (Active) Biotin conjugated

Applications
Functional Assay
Purity
99% Purity SDS -PAGE and HPLC.
Synonyms
PD-L1; N/A; Human PD-L1 Recombinant Fc fusion Protein (Active) Biotin conjugated; B7 homolog 1; CD274; B7H1; PDCD1L1; PDCD1LG1; PDL1; PD-L1 recombinant protein
Ordering
Host
CHO-K1 celline
Purity/Purification
99% Purity SDS -PAGE and HPLC.
Form/Format
Lyophilized sterile PBS, 5% trehalose and 0.01% tween 80 are added as protectant before lyophilization.
Sequence
Human PD-L1 (ECD): MRIFAVFIFMTYWHLLNAFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNER
Applicable Applications for PD-L1 recombinant protein
FA (Functional Assay)
Endotoxin
< 1.0 EU per ug of the protein as determined by the LAL method
Preparation and Storage
Store it under sterile conditions at -20 degree C to -80 degree C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

Application Data

(Figure-4: HPLC analysis of PD-L1/hFc recombinant protein.)

product-image-AAA78594_AD13.jpg Application Data (Figure-4: HPLC analysis of PD-L1/hFc recombinant protein.)

Application Data

(Figure-1: Human PD-L1/hFc recombinant protein. 0.5 ug protein was run on a 4-20% SDS-PAGE gel followed by Coomassie blue staining.)

product-image-AAA78594_AD15.jpg Application Data (Figure-1: Human PD-L1/hFc recombinant protein. 0.5 ug protein was run on a 4-20% SDS-PAGE gel followed by Coomassie blue staining.)
Related Product Information for PD-L1 recombinant protein
PD-L1 (CD274/B7-H1) is a critical membrane-bound costimulatory molecule belongs to the B7 superfamily that inhibits immune responses through its receptor, PD-1 and PD-L1 play a key role in the pathogenesis of inflammatory diseases (programmed death 1). It is widely expressed in the mononuclear phagocyte system (MPS), may co-stimulate T cells and regulates inflammatory responses. PD-L1 exerts inflammation regulatory functions via a negative co-stimulatory effect on T cell functions to inhibit cytokine secretion, facilitate apoptosis of activated T cells and induce T cell anergy. Aberrant expression and dysregulation of CD274 have been reported during bacterial infection, inflammation and in numerous autoimmune diseases. 
Product Categories/Family for PD-L1 recombinant protein

Similar Products

Product Notes

The PD-L1 (Catalog #AAA78594) is a Recombinant Protein produced from CHO-K1 celline and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's PD-L1 can be used in a range of immunoassay formats including, but not limited to, FA (Functional Assay). Researchers should empirically determine the suitability of the PD-L1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Human PD-L1 (ECD): MRIFAVFIFM TYWHLLNAFT VTVPKDLYVV EYGSNMTIEC KFPVEKQLDL AALIVYWEME DKNIIQFVHG EEDLKVQHSS YRQRARLLKD QLSLGNAALQ ITDVKLQDAG VYRCMISYGG ADYKRITVKV NAPYNKINQR ILVVDPVTSE HELTCQAEGY PKAEVIWTSS DHQVLSGKTT TTNSKREEKL FNVTSTLRIN TTTNEIFYCT FRRLDPEENH TAELVIPELP LAHPPNER. It is sometimes possible for the material contained within the vial of "PD-L1, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.