Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA282282_IF13.jpg IF (Immunofluorescence) (Immunofluorescence analysis of U2OS cells using ATG4D antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

Rabbit anti-Human ATG4D Polyclonal Antibody | anti-ATG4D antibody

ATG4D Rabbit pAb

Average rating 0.0
No ratings yet
Gene Names
SHMT2; GLYA; SHMT; HEL-S-51e
Reactivity
Human
Applications
Immunocytochemistry, Immunofluorescence, Western Blot
Purity
Affinity purification
Synonyms
ATG4D, Antibody; ATG4D Rabbit pAb; ATG4D; APG4-D; APG4D; AUTL4; cysteine protease ATG4D; anti-ATG4D antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.09% Sodium azide,50% glycerol,pH7.3.
Sequence
PSPFKHADIVTTTTHKTLRGARSGLIFYRKGVKAVDPKTGREIPYTFEDRINFAVFPSLQGGPHNHAIAAVAVALKQACTPMFREYSLQVLKNARAMADALLERGYSLVSGGTDNHLVLVDLRPKGLDGARAERVLELVSITANKNTCPGDRSAITPGGLRLGAPALTSRQFREDDFRRVVDFIDEGVNIGLEVKSKTAKLQDFKSFLLKDSETSQRLANLRQRVEQFARAFPMPGFDEH
Applicable Applications for anti-ATG4D antibody
ICC (Immunocytochemistry), IF (Immunofluorescence), WB (Western Blot)
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-230 of human ATG4D (NP_116274.3).
Cellular Location
Cytoplasm, Mitochondrion matrix
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IF (Immunofluorescence)

(Immunofluorescence analysis of U2OS cells using ATG4D antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

product-image-AAA282282_IF13.jpg IF (Immunofluorescence) (Immunofluorescence analysis of U2OS cells using ATG4D antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using ATG4D antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.)

product-image-AAA282282_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using ATG4D antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.)
Related Product Information for anti-ATG4D antibody
Autophagy is the process by which endogenous proteins and damaged organelles are destroyed intracellularly. Autophagy is postulated to be essential for cell homeostasis and cell remodeling during differentiation, metamorphosis, non-apoptotic cell death, and aging. Reduced levels of autophagy have been described in some malignant tumors, and a role for autophagy in controlling the unregulated cell growth linked to cancer has been proposed. This gene belongs to the autophagy-related protein 4 (Atg4) family of C54 endopeptidases. Members of this family encode proteins that play a role in the biogenesis of autophagosomes, which sequester the cytosol and organelles for degradation by lysosomes. Alternative splicing results in multiple transcript variants.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
504
NCBI Official Full Name
Serine hydroxymethyltransferase, mitochondrial
NCBI Official Synonym Full Names
serine hydroxymethyltransferase 2 (mitochondrial)
NCBI Official Symbol
SHMT2
NCBI Official Synonym Symbols
GLYA; SHMT; HEL-S-51e
NCBI Protein Information
serine hydroxymethyltransferase, mitochondrial; GLY A+; serine aldolase; serine methylase; threonine aldolase; serine hydroxymethylase; glycine hydroxymethyltransferase; epididymis secretory sperm binding protein Li 51e; glycine auxotroph A, human complem
UniProt Protein Name
Serine hydroxymethyltransferase, mitochondrial
UniProt Gene Name
SHMT2
UniProt Synonym Gene Names
SHMT
UniProt Entry Name
GLYM_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The ATG4D shmt2 (Catalog #AAA282282) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ATG4D Rabbit pAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ATG4D can be used in a range of immunoassay formats including, but not limited to, ICC (Immunocytochemistry), IF (Immunofluorescence), WB (Western Blot). Researchers should empirically determine the suitability of the ATG4D shmt2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: PSPFKHADIV TTTTHKTLRG ARSGLIFYRK GVKAVDPKTG REIPYTFEDR INFAVFPSLQ GGPHNHAIAA VAVALKQACT PMFREYSLQV LKNARAMADA LLERGYSLVS GGTDNHLVLV DLRPKGLDGA RAERVLELVS ITANKNTCPG DRSAITPGGL RLGAPALTSR QFREDDFRRV VDFIDEGVNI GLEVKSKTAK LQDFKSFLLK DSETSQRLAN LRQRVEQFAR AFPMPGFDEH. It is sometimes possible for the material contained within the vial of "ATG4D, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.