Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA282322_IHC8.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded human urothelial carcinoma using [KO Validated] delta-Catenin/p120 Catenin Rabbit pAb at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)

Rabbit anti-Human delta-Catenin/p120 Catenin Polyclonal Antibody | anti-p120 antibody

delta-Catenin/p120 Catenin Rabbit pAb

Average rating 0.0
No ratings yet
Gene Names
TPD52; D52; N8L; PC-1; PrLZ; hD52
Reactivity
Human
Applications
Immunohistochemistry, Western Blot
Purity
Affinity purification
Synonyms
delta-Catenin/p120 Catenin, Antibody; delta-Catenin/p120 Catenin Rabbit pAb; CTNND1; CAS; CTNND; P120CAS; P120CTN; p120; p120(CAS); p120(CTN); catenin delta-1; anti-p120 antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
MDRGEQGLLRTDPVPEEGEDVAATISATETLSEEEQEELRRELAKVEEEIQTLSQVLAAKEKHLAEIKRKLGINSLQELKQNIAKGWQDVTATSAYKKTSETLSQAGQKASAAFSSVGSVITKKLEDVKNSPTFKSFEEKVENLKSKVGGTKPAGGDFGEVLNSAANASATTTEPLPEKTQESL
Applicable Applications for anti-p120 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 573-832 of human delta-Catenin/p120 Catenin (NP_001078938.1).
Cellular Location
Cell membrane, Cytoplasm, Nucleus
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded human urothelial carcinoma using [KO Validated] delta-Catenin/p120 Catenin Rabbit pAb at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)

product-image-AAA282322_IHC8.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded human urothelial carcinoma using [KO Validated] delta-Catenin/p120 Catenin Rabbit pAb at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded human prostate cancer using [KO Validated] delta-Catenin/p120 Catenin Rabbit pAb at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)

product-image-AAA282322_IHC10.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded human prostate cancer using [KO Validated] delta-Catenin/p120 Catenin Rabbit pAb at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)

IHC (Immunohistochemisry)

(Immunohistochemistry of paraffin-embedded human liver cancer using [KO Validated] delta-Catenin/p120 Catenin Rabbit pAb at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)

product-image-AAA282322_IHC11.jpg IHC (Immunohistochemisry) (Immunohistochemistry of paraffin-embedded human liver cancer using [KO Validated] delta-Catenin/p120 Catenin Rabbit pAb at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using delta-Catenin/p120 Catenin antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 180s.)

product-image-AAA282322_WB13.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using delta-Catenin/p120 Catenin antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 180s.)

WB (Western Blot)

(Western blot analysis of extracts of HT-29 cells, using delta-Catenin/p120 Catenin antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 1s.)

product-image-AAA282322_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of HT-29 cells, using delta-Catenin/p120 Catenin antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 1s.)
Related Product Information for anti-p120 antibody
This gene encodes a member of the Armadillo protein family, which function in adhesion between cells and signal transduction. Multiple translation initiation codons and alternative splicing result in many different isoforms being translated. Not all of the full-length natures of the described transcript variants have been determined. Read-through transcription also exists between this gene and the neighboring upstream thioredoxin-related transmembrane protein 2 (TMX2) gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24,327 Da
NCBI Official Full Name
tumor protein D52 isoform 1
NCBI Official Synonym Full Names
tumor protein D52
NCBI Official Symbol
TPD52
NCBI Official Synonym Symbols
D52; N8L; PC-1; PrLZ; hD52
NCBI Protein Information
tumor protein D52; protein N8; prostate leucine zipper; prostate and colon associated protein
UniProt Protein Name
Tumor protein D52
UniProt Gene Name
TPD52
UniProt Entry Name
TPD52_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The p120 tpd52 (Catalog #AAA282322) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The delta-Catenin/p120 Catenin Rabbit pAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's delta-Catenin/p120 Catenin can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the p120 tpd52 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MDRGEQGLLR TDPVPEEGED VAATISATET LSEEEQEELR RELAKVEEEI QTLSQVLAAK EKHLAEIKRK LGINSLQELK QNIAKGWQDV TATSAYKKTS ETLSQAGQKA SAAFSSVGSV ITKKLEDVKN SPTFKSFEEK VENLKSKVGG TKPAGGDFGE VLNSAANASA TTTEPLPEKT QESL. It is sometimes possible for the material contained within the vial of "delta-Catenin/p120 Catenin, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.