Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA282398_WB13.jpg WB (Western Blot) (Western blot analysis of extracts from wild type(WT) and HER2/ErbB2 Rabbit pAb knockout (KO) HeLa cells, using HER2/ErbB2 Rabbit pAb antibody (AAA282398) at 1:500 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 180s.)

Rabbit anti-Human HER2/ErbB2 Polyclonal Antibody | anti-HER2/ErbB2 antibody

[KO Validated] HER2/ErbB2 Rabbit pAb

Average rating 0.0
No ratings yet
Gene Names
ERBB2; NEU; NGL; HER2; TKR1; CD340; HER-2; MLN 19; HER-2/neu
Reactivity
Human
Applications
Western Blot
Purity
Affinity purification
Synonyms
HER2/ErbB2, Antibody; [KO Validated] HER2/ErbB2 Rabbit pAb; NEU; NGL; HER2; TKR1; CD340; HER-2; VSCN2; MLN 19; MLN-19; c-ERB2; c-ERB-2; HER-2/neu; p185(erbB2); anti-HER2/ErbB2 antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
Liquid
PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Sequence
PLPAARPAGATLERPKTLSPGKNGVVKDVFAFGGAVENPEYLTPQGGAAPQPHPPPAFSPAFDNLYYWDQDPPERGAPPSTFKGTPTAENPEYLGLDVPV
Applicable Applications for anti-HER2/ErbB2 antibody
WB (Western Blot)
Positive Samples
HeLa, MCF7
Cellular Location
Cell membrane, Cytoplasm, Nucleus, Nucleus, Single-pass type I membrane protein, perinuclear region
Research Area
Protein phosphorylation, Cancer, Tumor immunology, Tumor-associated antigens, Tumor biomarkers, Signal Transduction, Kinase, Tyrosine kinases, ErbB-HER Signaling Pathway, Cell Biology Developmental Biology, Growth factors, Immunology Inflammation, CDs, Cardiovascular, Angiogenesis
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1156-1255 of human HER2/ErbB2 (NP_004439.2).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
Ship: Ice Pack

WB (Western Blot)

(Western blot analysis of extracts from wild type(WT) and HER2/ErbB2 Rabbit pAb knockout (KO) HeLa cells, using HER2/ErbB2 Rabbit pAb antibody (AAA282398) at 1:500 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 180s.)

product-image-AAA282398_WB13.jpg WB (Western Blot) (Western blot analysis of extracts from wild type(WT) and HER2/ErbB2 Rabbit pAb knockout (KO) HeLa cells, using HER2/ErbB2 Rabbit pAb antibody (AAA282398) at 1:500 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 180s.)

WB (Western Blot)

(Western blot analysis of MCF7, using HER2/ErbB2 Rabbit pAb antibody (AAA282398) at 1:500 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 180s.)

product-image-AAA282398_WB15.jpg WB (Western Blot) (Western blot analysis of MCF7, using HER2/ErbB2 Rabbit pAb antibody (AAA282398) at 1:500 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 180s.)
Related Product Information for anti-HER2/ErbB2 antibody
This gene encodes a member of the epidermal growth factor (EGF) receptor family of receptor tyrosine kinases. This protein has no ligand binding domain of its own and therefore cannot bind growth factors. However, it does bind tightly to other ligand-bound EGF receptor family members to form a heterodimer, stabilizing ligand binding and enhancing kinase-mediated activation of downstream signalling pathways, such as those involving mitogen-activated protein kinase and phosphatidylinositol-3 kinase. Allelic variations at amino acid positions 654 and 655 of isoform a (positions 624 and 625 of isoform b) have been reported, with the most common allele, Ile654/Ile655, shown here. Amplification and/or overexpression of this gene has been reported in numerous cancers, including breast and ovarian tumors. Alternative splicing results in several additional transcript variants, some encoding different isoforms and others that have not been fully characterized.
Product Categories/Family for anti-HER2/ErbB2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
137,910 Da
NCBI Official Full Name
receptor tyrosine-protein kinase erbB-2 isoform b
NCBI Official Synonym Full Names
v-erb-b2 erythroblastic leukemia viral oncogene homolog 2, neuro/glioblastoma derived oncogene homolog (avian)
NCBI Official Symbol
ERBB2
NCBI Official Synonym Symbols
NEU; NGL; HER2; TKR1; CD340; HER-2; MLN 19; HER-2/neu
NCBI Protein Information
receptor tyrosine-protein kinase erbB-2; herstatin; p185erbB2; proto-oncogene Neu; c-erb B2/neu protein; proto-oncogene c-ErbB-2; metastatic lymph node gene 19 protein; tyrosine kinase-type cell surface receptor HER2; neuroblastoma/glioblastoma derived on
UniProt Protein Name
Receptor tyrosine-protein kinase erbB-2
UniProt Gene Name
ERBB2
UniProt Synonym Gene Names
HER2; MLN19; NEU; NGL; MLN 19
UniProt Entry Name
ERBB2_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The HER2/ErbB2 erbb2 (Catalog #AAA282398) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The [KO Validated] HER2/ErbB2 Rabbit pAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HER2/ErbB2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the HER2/ErbB2 erbb2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: PLPAARPAGA TLERPKTLSP GKNGVVKDVF AFGGAVENPE YLTPQGGAAP QPHPPPAFSP AFDNLYYWDQ DPPERGAPPS TFKGTPTAEN PEYLGLDVPV. It is sometimes possible for the material contained within the vial of "HER2/ErbB2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.